- Prokineticin R1/PROKR1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83337
- Prokineticin R1/PROKR1
- This antibody was developed against Recombinant Protein corresponding to amino acids: GFMDDNATNT STSFLSVLNP HGAHATSFPF NFSYSDYDMP LDEDEDVTNS RTFF
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- GPR73, GPR73a, PK-R1, PKR1, ZAQ
- Unconjugated
- Human
- PBS (pH 7.2) and 40% Glycerol
- prokineticin receptor 1
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
Specifications/Features
Available conjugates: Unconjugated